You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324767 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TCF20 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TCF20 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 212kDa |
Target | TCF20 |
UniProt ID | Q9UGU0 |
Protein Sequence | Synthetic peptide located within the following region: HYPCAIDADCLLHEENFSVRCPKHKPPLPCPLPPLQNKTAKGSLSTEQSE |
NCBI | NP_005641 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti AR1 antibody, anti KIAA0292 antibody, anti SP Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-TCF20 Antibody, Catalog Number: orb324767, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Nuclear (nuclear membrane), Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 – 2.0 sec, Protocol located in Reviews and Data.
WB Suggested Anti-TCF20 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: OVCAR-3 cell lysate, TCF20 is supported by BioGPS gene expression data to be expressed in OVCAR3.
Filter by Rating