TCF12 antibody

• Catalog Number: orb592871
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TCF12
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Porcine, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TCF12
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 73kDa
• Target: TCF12
• UniProt ID: Q99081
• Protein Sequence: Synthetic peptide located within the following region: QQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDE
• NCBI: NP_996919
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HEB, p64, CRS3, HTF4, TCF-12, bHLHb20, HsT17266
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: TCF12, Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: TCF12, Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

WB Suggested Anti-TCF12 Antibody Titration: 0.06 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Lung.