TBC15 antibody

• Catalog Number: orb327394
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TBC15
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TBC15
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 76kDa
• Target: TBC1D15
• UniProt ID: Q8TC07
• Protein Sequence: Synthetic peptide located within the following region: DVNRTDRTNKFYEGQDNPGLILLHDILMTYCMYDFDLGYVQGMSDLLSPL
• NCBI: NP_073608
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti TBC1D15 antibody, anti antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human U937 Whole Cell tissue using TBC15 antibody

Host: Rabbit, Target Name: TBC15, Sample Type: U937 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.