You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330029 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TARDBP |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TARDBP |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 45kDa |
Target | TARDBP |
UniProt ID | Q13148 |
Protein Sequence | Synthetic peptide located within the following region: MGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWG |
NCBI | NP_031401 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti ALS10 antibody, anti TDP-43 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunohistochemical staining of human Liver tissue using TARDBP antibody
Immunohistochemical staining of human Heart tissue using TARDBP antibody
Immunohistochemical staining of human Heart tissue using TARDBP antibody
Western blot analysis of Jurkat tissue using TARDBP antibody
Western blot analysis of Jurkat cell lysate tissue using TARDBP antibody
Host: Rabbit, Target Name: TARDBP, Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.25 ug/mL, Peptide Concentration: 1.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.
Human Heart
Human Liver
Rabbit Anti-TARDBP antibody, Paraffin Embedded Tissue: Human Heart, cell Cellular Data: cardiac cell, Antibody Concentration: 4.0-8.0 ug/mL Magnification: 400X.
WB Suggested Anti-TARDBP Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate, TARDBP is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.
IHC, WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat | |
Canine, Equine, Guinea pig, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
Filter by Rating