TARDBP antibody

• Catalog Number: orb330028
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TARDBP
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TARDBP
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 45kDa
• Target: TARDBP
• UniProt ID: Q13148
• Protein Sequence: Synthetic peptide located within the following region: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQC
• NCBI: NP_031401
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ALS10 antibody, anti TDP-43 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human Liver tissue using TARDBP antibody

Immunohistochemical staining of human kidney tissue using TARDBP antibody

Western blot analysis of HepG2 tissue using TARDBP antibody

Western blot analysis of HepG2 cell lysate tissue using TARDBP antibody

25 ug of the indicated whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/mL of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/mL. Two or more isoforms of this protein are known and at least two share the N-terminal peptide sequence.

Host: Rabbit, Target Name: TARDBP, Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.25 ug/mL, Peptide Concentration: 1.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%. TARDBP is supported by BioGPS gene expression data to be expressed in HepG2.

Human kidney

Human Liver

WB Suggested Anti-TARDBP Antibody Titration: 1.25 ug/mL, Positive Control: HepG2 cell lysate, TARDBP is supported by BioGPS gene expression data to be expressed in HepG2.