You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb443223 |
---|---|
Category | Antibodies |
Description | TANK Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, IHC, IHC-Fr, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human TANK (MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQK). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 48 kDa |
UniProt ID | Q92844 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | TRAF family member-associated NF-kappa-B activator Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of A431 cells using anti-TANK antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of TANK using anti-TANK antibody.Lane 1:human HeLa Cell;2:human placenta tissue;3:human A549 Cell;4:human MDA-MB-453 Cell;5:human SW620 Cell;6:human 22RV1 Cell;7:human SW579 Cell.
WB analysis of TANK using anti-TANK antibody.Lane 1:rat brain tissue;2:rat lung tissue;3:rat spleen tissue;4:rat kidney tissue;5:mouse brain tissue;6:mouse lung tissue;7:mouse spleen tissue;8:mouse kidney tissue.
IHC analysis of TANK using anti-TANK antibody.TANK was detected in paraffin-embedded section of mouse liver tissues.
IHC analysis of TANK using anti-TANK antibody.TANK was detected in paraffin-embedded section of rat small intestine tissue.
IHC analysis of TANK using anti-TANK antibody.TANK was detected in paraffin-embedded section of rat spleen tissue.
IHC analysis of TANK using anti-TANK antibody.TANK was detected in paraffin-embedded section of human cholangiocarcinoma tissue.
IHC analysis of TANK using anti-TANK antibody.TANK was detected in paraffin-embedded section of human placenta tissue.
IHC analysis of TANK using anti-TANK antibody.TANK was detected in paraffin-embedded section of human rectal cancer tissue.
IHC analysis of TANK using anti-TANK antibody.TANK was detected in paraffin-embedded section of mouse kidney tissues.
IHC analysis of TANK using anti-TANK antibody.TANK was detected in frozen section of human placenta tissues.
ELISA, IF, IHC | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating