You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592842 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TAL1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TAL1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 34kDa |
Target | TAL1 |
UniProt ID | P17542 |
Protein Sequence | Synthetic peptide located within the following region: QDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADGAGPR |
NCBI | NP_003180 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | SCL, TCL5, tal-1, bHLHa17 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Human Breast
Human Breast
Human Liver
Rabbit Anti-TAL1 Antibody, Paraffin Embedded Tissue: Human hepatocyte cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-TAL1 Antibody Titration: 0.6 ug/ml, Positive Control: Fetal Muscle cell lysate.
ICC, IF, IHC-P, WB | |
Guinea pig, Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Guinea pig, Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating