You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575142 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TAF9 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ChIP, IHC, WB |
Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TAF9 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 19kDa |
Target | TAF9 |
UniProt ID | Q9Y3D8 |
Protein Sequence | Synthetic peptide located within the following region: GLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVD |
NCBI | NP_001015891 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | TAF2G, TAFII31, TAFII32, MGC:5067, TAFII-31, TAFII Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Human Skin
Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
WB Suggested Anti-TAF9 Antibody Titration: 0.125 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Small Intestine.
ELISA, IF, IHC-P, WB | |
Bovine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating