You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb333131 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TAF12 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ChIP, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TAF12 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 18kDa |
Target | TAF12 |
UniProt ID | Q16514 |
Protein Sequence | Synthetic peptide located within the following region: MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRL |
NCBI | NP_005635 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti TAF2J antibody, anti TAFII20 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of Transfected 293T tissue using TAF12 antibody
ChIP analysis of human colon carcinoma using TAF12 antibody
Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
WB Suggested Anti-TAF12 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T. TAF12 is supported by BioGPS gene expression data to be expressed in HEK293T.
Filter by Rating