TAB2 antibody

• Catalog Number: orb324417
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TAB2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAP3K7IP2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 76kDa
• Target: TAB2
• UniProt ID: Q9NYJ8
• Protein Sequence: Synthetic peptide located within the following region: QKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSG
• NCBI: NP_055908
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CHTD2 antibody, anti MAP3K7IP2 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human Spermatophore tissue using TAB2 antibody

Western blot analysis of HepG2 cell lysate tissue using TAB2 antibody

Immunohistochemical staining of human Stomach tissue using TAB2 antibody

Human Spermatophore

Human Stomach

WB Suggested Anti-MAP3K7IP2 Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate, TAB2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.