TAAR5 antibody

• Catalog Number: orb584398
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TAAR5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TAAR5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 38kDa
• Target: TAAR5
• UniProt ID: Q5QD28
• Protein Sequence: Synthetic peptide located within the following region: GWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSLAGAAKHERKA
• NCBI: NP_003958
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PNR, taR-5
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunofluorescence: Dilution - 3 ug/ml.

Sample Type: Spinal Cord, ventral horns.

WB Suggested Anti-TAAR5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate. TAAR5 is supported by BioGPS gene expression data to be expressed in HEK293T.