You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584397 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TAAR5 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IF, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TAAR5 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 38kDa |
Target | TAAR5 |
UniProt ID | O14804 |
Protein Sequence | Synthetic peptide located within the following region: TTLSKSLAGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITP |
NCBI | NP_003958 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PNR, taR-5 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunofluorescence - dilution: 1.3 ug/ml.
WB Suggested Anti-TAAR5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: PANC1 cell lysate. TAAR5 is supported by BioGPS gene expression data to be expressed in PANC1.
WB Suggested Anti-TAAR5 antibody Titration: 1 ug/ml, Sample Type: Human OVCAR-3.
IF, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating