You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331045 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Syt1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 47kDa |
Target | Syt1 |
UniProt ID | P46096 |
Protein Sequence | Synthetic peptide located within the following region: FDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSL |
NCBI | NP_033332 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti AW124717 antibody, anti G630098F17Rik antibod Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: complete mouse retina sections, Red: Primary, Blue: DAPI, Primary dilution: 1:200, Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L), Secondary dilution: 1:200.
Sample Type: outer mouse plexiform layer, Red: Primary, Blue: DAPI, Primary dilution: 1:200, Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L), Secondary dilution: 1:200.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein is lipidated and may be phosphorylated.
Lanes: Lane 1: 10 ug mouse cortex brain lysate, Lane 2: 25 ug mouse cortex brain lysate, Lane 3: 40 ug mouse cortex brain lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:2000, Gene Name: Syt1.
Syt1 antibody - middle region (orb331045) validated by WB using Mouse Spleen lysate at 1.0 ug/ml.
FC, ICC, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating