You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578569 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SYDE1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SYDE1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 80kDa |
Target | SYDE1 |
UniProt ID | Q6ZW31 |
Protein Sequence | Synthetic peptide located within the following region: PSPPEPEPQAPEGSQAGAEGPSSPEASRSPARGAYLQSLEPSSRRWVLGG |
NCBI | NP_149014 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | 7h3, SYD1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Lanes: 1: 2 ug mouse SYDE1 transfected HEK293T lysate, 2: 15 ug untransfected HEK293T lysate, 3: 100 ug wild type mouse brain lysate, 4: 100 ug SYDE1 knock-out mouse brain lysate, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit L-chain HRP, Secondary Antibody Dilution: 1:10000, Gene Name: SYDE1.
WB Suggested Anti-SYDE1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.
Filter by Rating