Swine CCL5 Recombinant Protein

Catalog Number: orb1820925

Catalog Number	orb1820925
Category	Proteins
Description	The Swine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFSYLSRPLPRAHLQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINTLEMS) (Gene ID: 396613).
Form/Appearance	Lyophilized
Purity	98%
MW	7.9 kDa
Target	CCL5
Entrez	396613
Protein Sequence	SPYASDTTPCCFSYLSRPLPRAHLQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINTLEMS
Protein Length	68
Source	Yeast
Storage	-20°C
Alternative names	RANTES Read more...
Note	For research use only
Expiration Date	6 months from date of receipt.