You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325667 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Suv420h1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ChIP, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish |
Reactivity | Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 32 kDa |
Target | KMT5B |
UniProt ID | Q3U8K7 |
Protein Sequence | Synthetic peptide located within the following region: FINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFC |
NCBI | NP_001161356 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti AA117471 antibody, anti C630029K18Rik antibod Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 2 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL. Multiple isoforms of this protein are expressed in the samples shown as indicated.
Chromatin Immunoprecipitation (ChIP) Using Suv420h1 antibody - C-terminal region (orb325667) and HCT116 Cells.
Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
WB Suggested Anti-Suv420h1 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Thymus.
IHC, WB | |
Canine, Equine, Guinea pig, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Canine, Equine, Guinea pig, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating