SUV420H1 antibody

• Catalog Number: orb324552
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SUV420H1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SUV420H1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 52kDa
• Target: KMT5B
• UniProt ID: Q4V775
• Protein Sequence: Synthetic peptide located within the following region: NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR
• NCBI: AAH98121
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CGI85 antibody, anti KMT5B antibody, anti CGI
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-SUV420H1 Antibody, Paraffin Embedded Tissue: Human Skin Cellular Data: Squamous epithelial cells Antibody Concentration: 4.0-8.0 ug/mL Magnification: 400X.

WB Suggested Anti-SUV420H1 Antibody Titration: 0.2-1 ug/mL ELISA Titer: 1:1562500 Positive Control: Human Placenta.

WB Suggested Anti-SUV420H1 Antibody, Titration: 1.25 ug/mL, Positive Control: Jurkat Whole Cell.