You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574637 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SUPT5H |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Rabbit, Zebrafish |
Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SUPT5H |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 121kDa |
Target | SUPT5H |
UniProt ID | O00267 |
Protein Sequence | Synthetic peptide located within the following region: PYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQA |
NCBI | NP_003160 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | SPT5, SPT5H, Tat-CT1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide sequence is contained in an isoform present at ~105 kDa. The protein is heavily modified by phosphorylation.
Host: Rabbit, Target Name: SUPT5H, Sample Tissue: Human Hela Whole Cell, Antibody dilution: 3 ug/ml.
Host: Rabbit, Target Name: SUPT5H, Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 3 ug/ml.
Host: Rabbit, Target Name: SUPT5H, Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 3 ug/ml.
Human kidney
Human Pancreas
Rabbit Anti-SUPT5H Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-SUPT5H Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IHC-Fr, IHC-P, WB | |
Human | |
Rabbit | |
Monoclonal | |
Unconjugated |
Filter by Rating