SUN1 antibody

• Catalog Number: orb325524
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SUN1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UNC84A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 90kDa
• Target: SUN1
• UniProt ID: O94901
• Protein Sequence: Synthetic peptide located within the following region: QDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGA
• NCBI: NP_079430
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FLJ12407 antibody, anti KIAA0810 antibody, an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Jurkat Whole Cell tissue using SUN1 antibody

Western blot analysis of Jurkat cell lysate tissue using SUN1 antibody

Immunohistochemical staining of mouse C2C12 tissue using SUN1 antibody

Western blot analysis of human Fetal Lung tissue using SUN1 antibody

Western blot analysis of human Placenta tissue using SUN1 antibody

Host: Rabbit, Target Name: SUN1, Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: SUN1, Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: SUN1, Sample Type: Jurkat Whole Cell lysates, Antibody Dilution: 3 ug/mL.

Host: Rabbit, Target Name: UNC84A, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: UNC84A, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

Sample Type: Mouse C2C12 cells, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 488, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: UNC84a: Green DAPI: Blue, Gene Name: UNC84A.

WB Suggested Anti-UNC84A Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.