You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334553 |
---|---|
Category | Antibodies |
Description | SULT2A1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human SULT2A1 (253-285aa DWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE), different from the related mouse sequence by seven amino acids, and from the related rat sequence by eight amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 33780 MW |
UniProt ID | Q06520 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Bile salt sulfotransferase;2.8.2.14;Dehydroepiandr Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of SULT2A1 using anti-SULT2A1 antibody.Lane 1:human hepatocellular carcinoma tumor tissue (HCCT) lysates;2:human hepatocellular carcinoma paracancerous tissue (HCCP) lysates;3:human HepG2 cell;4:rat liver tissue.
IHC analysis of SULT2A1 using anti-SULT2A1 antibody. SULT2A1 was detected in a paraffin-embedded section of human renal cancer tissue.
IHC analysis of SULT2A1 using anti-SULT2A1 antibody. SULT2A1 was detected in a paraffin-embedded section of rat liver tissue.
IHC analysis of SULT2A1 using anti-SULT2A1 antibody. SULT2A1 was detected in a paraffin-embedded section of mouse liver tissue.
Filter by Rating