SULT1A1 monoclonal antibody (M01A), clone 1F8

• Catalog Number: orb2292110
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant SULT1A1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1F8
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgM kappa
• Immunogen: SULT1A1 (AAH00923, 1 a.a. ~ 295 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
• NCBI: AAH00923
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In ascites fluid
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoprecipitation of SULT1A1 transfected lysate using anti-SULT1A1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SULT1A1 monoclonal antibody.

Western Blot analysis of SULT1A1 expression in transfected 293T cell line by SULT1A1 monoclonal antibody (M01A), clone 1F8. Lane 1: SULT1A1 transfected lysate (33.925 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (58.19 KDa).