You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292110 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant SULT1A1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1F8 |
Tested applications | ELISA, IP, WB |
Reactivity | Human |
Isotype | IgM kappa |
Immunogen | SULT1A1 (AAH00923, 1 a.a. ~ 295 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL |
NCBI | AAH00923 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In ascites fluid |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunoprecipitation of SULT1A1 transfected lysate using anti-SULT1A1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SULT1A1 monoclonal antibody.
Western Blot analysis of SULT1A1 expression in transfected 293T cell line by SULT1A1 monoclonal antibody (M01A), clone 1F8. Lane 1: SULT1A1 transfected lysate (33.925 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (58.19 KDa).
Filter by Rating