You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580659 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SULT1A1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SULT1A1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 34kDa |
Target | SULT1A1 |
UniProt ID | P50226 |
Protein Sequence | Synthetic peptide located within the following region: ELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGT |
NCBI | NP_001046 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PST, STP, STP1, P-PST, ST1A1, ST1A3, TSPST1, HAST1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
SULT1A1 antibody - N-terminal region (orb580659), Catalog Number: orb580659, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
SULT1A1 antibody - N-terminal region (orb580659), Catalog Number: orb580659, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasm of pneumocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-SULT1A1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Liver.
Filter by Rating