SUFU antibody

• Catalog Number: orb577020
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SUFU
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SUFU
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 54kDa
• Target: SUFU
• UniProt ID: Q9UMX1
• Protein Sequence: Synthetic peptide located within the following region: LQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVFD
• NCBI: NP_057253
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SUFUH, JBTS32, SUFUXL, PRO1280
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: SUFU, Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.

Immunohistochemistry with Uterus tissue at an antibody concentration of 5 ug/ml using anti-SUFU antibody (orb577020).

WB Suggested Anti-SUFU Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate.