You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1495139 |
---|---|
Category | Proteins |
Description | Streptavidin Recombinant Protein |
Species/Host | E. coli |
Tag | His-tag |
MW | ~38kDa |
UniProt ID | P22629 |
Solubility (25°C) | PBS, 4M Urea, PH7.4 |
Protein Sequence | MRKIVVAAIAVSLTTVSITASASADPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ |
Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Buffer/Preservatives | PBS, 4M Urea, pH 7.4 |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Filter by Rating