You have no items in your shopping cart.
Cart summary
Streptavidin Protein, S. avidinii, Recombinant (His)
Catalog Number: orb1976320
| Catalog Number | orb1976320 |
|---|---|
| Category | Proteins |
| Description | The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin). Streptavidin Protein, S. avidinii, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.5 kDa and the accession number is P22629. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 18.5 kDa (predicted) |
| UniProt ID | P22629 |
| Protein Sequence | DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Streptomyces avidinii |
| Biological Activity | The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin). Streptavidin Protein, S. avidinii, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.5 kDa and the accession number is P22629. |
| Expression Region | 25-183 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
