You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb81395 |
---|---|
Category | Proteins |
Description | Recombinant of Streptavidin protein |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
Purity | Greater than 98.0% as determined by SDS-PAGE and HPLC. |
Solubility (25°C) | It is recommended to reconstitute the lyophilized Streptavidin in sterile 18MΩ-cm H2O not less than 0.5mg/ml, which can then be further diluted to other aqueous solutions. |
Protein Sequence | MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS |
Source | Escherichia Coli |
Storage | Stability: Streptavidin is shipped at ambient temperature, upon arrival store at -20°C |
Buffer/Preservatives | Lyophilized in 10mM potassium phosphate buffer pH 6.5. |
Note | For research use only |
Application notes | Proteolytic Activity: < 10-3 U/mg protein (Azocoll, 25 °C, 24 h, pH 8.0) |
Expiration Date | 6 months from date of receipt. |
FA, HPLC, SDS-PAGE | |
Unconjugated | |
< p>> 98% pure by SDS-PAGE and HPLC analyses. | |
7.6 kDa |
Greater than 90% as determined by SDS-PAGE. | |
43.5 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
18.5 kDa | |
Yeast |