STK3 antibody

• Catalog Number: orb580492
• Category: Antibodies
• Description: Rabbit polyclonal antibody to STK3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human STK3
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56kDa
• Target: STK3
• UniProt ID: Q13188
• Protein Sequence: Synthetic peptide located within the following region: IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQ
• NCBI: NP_006272
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: KRS1, MST2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: STK3, Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: STK3, Sample Tissue: Human Lung Tumor, Antibody dilution: 1.0 ug/ml.

Lanes: Lane 1: 100 ug uninduced RPE-1 lysate, Lane 2: 100 ug uninduced RPE-1 lysate, Lane 3: 100 ug STK3 induced RPE-1 lysate, Lane 4: 100 ug STK3 induced RPE-1 lysate, Primary Antibody dilution: 1:2000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: STK3.

Lanes: Lane 1: 100 ug untransfected COS-7 lysate, Lane 2: 100 ug mock transfected Cos-7 lysate, Lane 3: 100 ug STK3 transfected Cos-7 lysate, Lane 4: 50 ug STK3 transfected Cos-7 lysate, Lane 5: 25 ug STK3 transfected Cos-7 lysate, Primary Antibody dilution: 1:2000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: STK3.

Rabbit Anti-STK3 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-STK3 Antibody Titration: 5.0 ug/ml, Positive Control: HepG2 cell lysate.