Cart summary

You have no items in your shopping cart.

    Stathmin 1/STMN1 Antibody

    Catalog Number: orb308855

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb308855
    CategoryAntibodies
    DescriptionStathmin 1/STMN1 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, ICC, IF, IHC, WB
    Predicted ReactivityBovine
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human Stathmin 1 (2-34aa ASSDIQVKELEKRASGQAFELILSPRSKESVPE), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW17303 MW
    UniProt IDP16949
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesStathmin;Leukemia-associated phosphoprotein p18;Me
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    Stathmin 1/STMN1 Antibody

    Flow Cytometry analysis of THP-1 cells using anti-Stathmin 1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    Stathmin 1/STMN1 Antibody

    Flow Cytometry analysis of RAW264.7 cells using anti-Stathmin 1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    Stathmin 1/STMN1 Antibody

    Flow Cytometry analysis of RH-35 cells using anti-Stathmin 1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    Stathmin 1/STMN1 Antibody

    WB analysis of Stathmin 1 using anti-Stathmin 1 antibody.Lane 1:rat brain tissue;2:rat testis tissue;3:mouse brain tissue;4:mouse testis tissue; 5:human MDA-MB-453 cell; 6:human SH-SY5Y cell;6:human Raji cell.

    Stathmin 1/STMN1 Antibody

    IF analysis of Stathmin 1 using anti-Stathmin 1 antibody. Stathmin 1 was detected in immunocytochemical section of MCF7 cells.

    Stathmin 1/STMN1 Antibody

    IHC analysis of Stathmin 1 using anti-Stathmin 1 antibody. Stathmin 1 was detected in paraffin-embedded section of human placenta tissue.

    Stathmin 1/STMN1 Antibody

    IHC analysis of Stathmin 1 using anti-Stathmin 1 antibody. Stathmin 1 was detected in paraffin-embedded section of human intestinal cancer tissue.

    Stathmin 1/STMN1 Antibody

    IHC analysis of Stathmin 1 using anti-Stathmin 1 antibody. Stathmin 1 was detected in paraffin-embedded section of mouse brain tissue.

    Stathmin 1/STMN1 Antibody

    IHC analysis of Stathmin 1 using anti-Stathmin 1 antibody. Stathmin 1 was detected in paraffin-embedded section of rat brain tissue.

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars