You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576926 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to STAT5B |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human STAT5B |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 90kDa |
Target | STAT5B |
UniProt ID | P51692 |
Protein Sequence | Synthetic peptide located within the following region: AVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNP |
NCBI | NP_036580 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | STAT5, GHISID2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Anti-STAT5B antibody IHC staining of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Anti-STAT5B antibody IHC staining of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Rabbit Anti-STAT5B Antibody, Paraffin Embedded Tissue: Human Testis, Antibody Concentration: 5 ug/ml.
WB Suggested Anti-STAT5B Antibody Titration: 1 ug/ml, Positive Control: 293T cells lysate. There is BioGPS gene expression data showing that STAT5B is expressed in HEK293T.
IHC-P, WB | |
Guinea pig, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, WB | |
Human, Mouse | |
Monoclonal | |
Unconjugated |
FC | |
Human, Mouse | |
Monoclonal | |
Unconjugated |
FC, ICC, IF, WB | |
Bovine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating