You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574631 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to STAT4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Canine, Equine, Porcine, Rabbit, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human STAT4 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 86 kDa |
Target | STAT4 |
UniProt ID | Q14765 |
Protein Sequence | Synthetic peptide located within the following region: IGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQ |
NCBI | NP_003142 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | SLEB11 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Other isoforms containing peptide include 82 kDa, 72 kDa, 55 kDa and 40 kDa and canonical protein is phosphorylated.
Host: Mouse, Target Name: STAT4, Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: STAT4, Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.
Human Muscle
Rabbit Anti-STAT4 antibody, Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-STAT4 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, STAT4 is supported by BioGPS gene expression data to be expressed in Jurkat.
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating