STAT3 monoclonal antibody (M02), clone 4D6

• Catalog Number: orb2292115
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant STAT3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4D6
• Tested applications: ELISA, IF, PLA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: STAT3 (NP_003141, 670 a.a. ~ 769 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: LVYLYPDIPKEEAFGKYCRPESQEHPEADPGAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
• NCBI: NP_003141
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged STAT3 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to STAT3 on HeLa cell. [antibody concentration 10 ug/ml]

Proximity Ligation Analysis of protein-protein interactions between NFKB1 and STAT3. HeLa cells were stained with anti-NFKB1 rabbit purified polyclonal 1:1200 and anti-STAT3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

STAT3 monoclonal antibody (M02), clone 4D6 Western Blot analysis of STAT3 expression in HeLa.

Western Blot detection against Immunogen (36.74 KDa).