You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592766 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to STAT3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human STAT3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 88kDa |
Target | STAT3 |
UniProt ID | P40763 |
Protein Sequence | Synthetic peptide located within the following region: FGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLD |
NCBI | NP_644805 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | APRF, HIES, ADMIO, ADMIO1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The peptide is also present in a 83 kDa isoform.The protein may be modified by acetylation and phosphorylation.
Host: Rabbit, Target Name: STAT3, Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: STAT3, Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/ml.
Human Uterus
Immunohistochemistry with Thymus tissue at an antibody concentration of 5.0 ug/ml using anti-STAT3 antibody (orb592766).
WB Suggested Anti-STAT3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: 721_B cell lysate. STAT3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
IF, IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Bovine, Canine, Guinea pig, Porcine, Rabbit, Sheep | |
Gallus, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, IF, IHC | |
Bovine, Human, Mouse, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
IHC, IP, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
Filter by Rating