You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579846 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ST3GAL4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ST3GAL4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 37kDa |
Target | ST3GAL4 |
UniProt ID | Q6IBE6 |
Protein Sequence | Synthetic peptide located within the following region: IKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSM |
NCBI | NP_006269 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | STZ, SAT3, ST-4, CGS23, SIAT4, NANTA3, SIAT4C, ST3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: EGFL8, Sample Type: Hela, Antibody dilution: 1.0 ug/ml. ST3GAL4 is supported by BioGPS gene expression data to be expressed in HeLa.
Host: Rabbit, Target Name: NOP56, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. ST3GAL4 is supported by BioGPS gene expression data to be expressed in MCF7.
Host: Rabbit, Target Name: ST3GAL4, Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target: ST3GAL4, Positive control (+): Hela (HL), Negative control (-): 293T (2T), Antibody concentration: 3 ug/ml.
WB Suggested Anti-ST3GAL4 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate. ST3GAL4 is supported by BioGPS gene expression data to be expressed in 721_B.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating