You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579882 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ST3GAL2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ST3GAL2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 40 kDa |
Target | ST3GAL2 |
UniProt ID | Q16842 |
Protein Sequence | Synthetic peptide located within the following region: ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN |
NCBI | NP_008858 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | SIAT4B, ST3GALII, Gal-NAc6S, ST3GalA.2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/ml.
WB Suggested Anti-ST3GAL2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human heart.
Filter by Rating