You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575622 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SSX4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SSX4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 22kDa |
Target | SSX4 |
UniProt ID | O60224 |
Protein Sequence | Synthetic peptide located within the following region: FPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGP |
NCBI | NP_005627 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CT5.4 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: SSX4, Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. SSX4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Host: Rabbit, Target Name: SSX4, Sample Type: Hela, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: SSX4, Sample Type: HepG2, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: SSX4, Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: SSX4, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml.
Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0 ug/ml using anti-SSX4 antibody (orb575622).
WB Suggested Anti-SSX4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.
Filter by Rating