You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330721 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SSX2IP |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SSX2IP |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 68kDa |
Target | SSX2IP |
UniProt ID | Q9Y2D8 |
Protein Sequence | Synthetic peptide located within the following region: KVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATA |
NCBI | NP_054740 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti ADIP antibody, anti FLJ10848 antibody, anti K Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunohistochemical staining of human kidney tissue using SSX2IP antibody
Western blot analysis of 721_B cell lysate tissue using SSX2IP antibody
Immunohistochemical staining of human kidney tissue using SSX2IP antibody
Human kidney
Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0 ug/ml using anti-SSX2IP antibody (orb330721).
WB Suggested Anti-SSX2IP Antibody Titration: 1 ug/ml, Positive Control: 721_B cell lysate.
ICC, IHC-Fr, IHC-P, WB | |
Human, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
Filter by Rating