You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330594 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SRPRB |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SRPRB |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 30 kDa |
Target | SRPRB |
UniProt ID | Q9Y5M8 |
Protein Sequence | Synthetic peptide located within the following region: QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTAPAQLGKKGKE |
NCBI | NP_067026 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti APMCF1 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: SRPRB, Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. SRPRB is supported by BioGPS gene expression data to be expressed in 721_B.
Host: Rabbit, Target Name: SRPRB, Sample Type: Hela, Antibody dilution: 1.0 ug/ml. SRPRB is supported by BioGPS gene expression data to be expressed in HeLa.
Host: Rabbit, Target Name: SRPRB, Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. SRPRB is supported by BioGPS gene expression data to be expressed in Jurkat.
Host: Rabbit, Target: SRPRB, Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): NTERA-2 Cell Lysate (N27), Antibody concentration: 1 ug/ml.
Rabbit Anti-SRPRB Antibody, Catalog Number: orb330594, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-SRPRB Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate, SRPRB is supported by BioGPS gene expression data to be expressed in HeLa.
ELISA, FC, ICC, IF, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating