SRP54 antibody

• Catalog Number: orb330132
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SRP54
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SRP54
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56kDa
• Target: SRP54
• UniProt ID: P61011
• Protein Sequence: Synthetic peptide located within the following region: ENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEA
• NCBI: NP_003127
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SCN8
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of Hum. Placenta tissue using SRP54 antibody

Western blot analysis of human Placenta tissue using SRP54 antibody

Host: Rabbit, Target: SRP54, Positive control (+): MCF7 (N10), Negative control (-): 293T (2T), Antibody concentration: 1 ug/mL.

Hum. Adult Placenta.

SRP54 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb330132 with 1:200 dilution. Western blot was performed using orb330132 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: SRP54 IP with orb330132 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

WB Suggested Anti-SRP54 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Placenta.