You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb588973 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SRD5A1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SRD5A1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 29 kDa |
Target | SRD5A1 |
UniProt ID | P18405 |
Protein Sequence | Synthetic peptide located within the following region: RFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANY |
NCBI | NP_001038.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | S5AR 1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: SRD5A1, Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: SRD5A1, Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1.0 ug/ml.
ELISA, IHC | |
Bovine, Canine, Human, Mouse, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
ELISA, IHC | |
Bovine, Canine, Mouse, Rat | |
Human | |
Goat | |
Polyclonal | |
Unconjugated |
ELISA, FC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating