You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330733 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SQSTM1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SQSTM1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 48kDa |
Target | SQSTM1 |
UniProt ID | Q13501 |
Protein Sequence | Synthetic peptide located within the following region: EEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQE |
NCBI | NP_003891 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti A170 antibody, anti OSIL antibody, anti PDB3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: SQSTM1, Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: SQSTM1, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: SQSTM1, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: SQSTM1, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Pancreas
Rabbit Anti-SQSTM1 Antibody, Catalog Number: orb330733, Formalin Fixed Paraffin Embedded Tissue: Human Thyroid Gland Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-SQSTM1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Pancreas.
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC, WB | |
Human, Mouse, Rabbit | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
ICC, IF, IHC, WB | |
Hamster | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating