SPINK1 monoclonal antibody (M01), clone 4D4

• Catalog Number: orb2292132
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SPINK1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4D4
• Tested applications: ELISA, IHC-P, IP, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: SPINK1 (AAH25790, 24 a.a. ~ 79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
• NCBI: AAH25790
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged SPINK1 is 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to SPINK1 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 1 ug/ml]

Immunoprecipitation of SPINK1 transfected lysate using anti-SPINK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SPINK1 MaxPab rabbit polyclonal antibody.

SPINK1 monoclonal antibody (M01), clone 4D4. Western Blot analysis of SPINK1 expression in human pancreas.

Western Blot detection against Immunogen (31.9 KDa).