You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2003644 |
---|---|
Category | Proteins |
Description | This is a synthetic peptide designed for use in combination with anti-SPDYE3 Antibody (ARP72109_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Tested applications | WB |
Form/Appearance | Lyophilized powder |
MW | 60kDa |
UniProt ID | A6NKU9 |
Protein Sequence | Synthetic peptide located within the following region: MTSHQPQPQEEQSPQRSTSGYPLQEVVDDEVSGPSAPGVDPSPPRRSLGC |
NCBI | NP_001004351 |
Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
Buffer/Preservatives | Lyophilized powder |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Filter by Rating