SPARC monoclonal antibody (M02), clone 1B2

• Catalog Number: orb2292133
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant SPARC.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1B2
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: SPARC (AAH04974.1, 1 a.a. ~ 303 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
• NCBI: AAH04974.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged SPARC is approximately 3 ng/ml as a capture antibody.

SPARC monoclonal antibody (M02), clone 1B2 Western Blot analysis of SPARC expression in A-431.

SPARC monoclonal antibody (M02), clone 1B2. Western Blot analysis of SPARC expression in human kidney.

Western Blot analysis of SPARC expression in transfected 293T cell line by SPARC monoclonal antibody (M02), clone 1B2. Lane 1: SPARC transfected lysate (34.6 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (59.07 KDa).