You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585916 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SPAM1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human SPAM1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 58 kDa |
Target | SPAM1 |
UniProt ID | P38567 |
Protein Sequence | Synthetic peptide located within the following region: QQQNVQLSLTEATEKAKQEFEKAGKDFLVETIKLGKLLRPNHLWGYYLFP |
NCBI | NP_694859 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HYA1, PH20, HYAL1, HYAL3, HYAL5, PH-20, SPAG15, HE Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: SPAM1, Sample Type: 786-0 Whole cell lysates, Antibody dilution: 1.0 ug/ml.
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
FC, IHC-P | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating