You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585915 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SPAM1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human SPAM1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 58kDa |
Target | SPAM1 |
UniProt ID | P38567 |
Protein Sequence | Synthetic peptide located within the following region: CYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPMETEEPQIFYNASP |
NCBI | NP_694859 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HYA1, PH20, HYAL1, HYAL3, HYAL5, PH-20, SPAG15, HE Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: SPAM1, Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.
Host: Rabbit, Target Name: SPAM1, Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 0.2 ug/ml.
Host: Rabbit, Target Name: SPAM1, Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: SPAM1, Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 3 ug/ml.
Host: Rabbit, Target Name: SPAM1, Sample Type: 293T, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: SPAM1, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
WB Suggested Anti-SPAM1 Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell.
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
FC, IHC-P | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating