Spa17 antibody

• Catalog Number: orb325885
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Spa17
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Spa17
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 16kDa
• Target: Spa17
• UniProt ID: Q9Z1K2
• Protein Sequence: Synthetic peptide located within the following region: AYFENLLEKREKTSFDPAEWGAKVEDRFYNNHAFKDPEQAEKCEQEIAKA
• NCBI: NP_445934
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti Sp17 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of rat Small Intestine tissue using Spa17 antibody

WB Suggested Anti-Spa17 Antibody, Titration: 1.0 ug/mL, Positive Control: Rat Small Intestine.