SPA17 antibody

• Catalog Number: orb325884
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SPA17
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Sheep, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SPA17
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 17kDa
• Target: SPA17
• UniProt ID: Q15506
• Protein Sequence: Synthetic peptide located within the following region: MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKR
• NCBI: NP_059121
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti SP17 antibody, anti SP17-1 antibody, anti CT2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human heart tissue using SPA17 antibody

WB Suggested Anti-SPA17 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Human heart.