SP110 antibody

• Catalog Number: orb575811
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SP110
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SP110
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 81kDa
• Target: SP110
• UniProt ID: Q9HB58
• Protein Sequence: Synthetic peptide located within the following region: DMRLMFRNHKTFYKASDFGQVGLDLEAEFEKDLKDVLGFHEANDGGFWTL
• NCBI: NP_536349
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: IPR1, VODI, IFI41, IFI75
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: SP110, Sample Type: Human MCF7, Antibody Dilution: 1.0 ug/ml. SP110 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.

WB Suggested Anti-SP110 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HT1080 cell lysate. There is BioGPS gene expression data showing that SP110 is expressed in HT1080.