You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592879 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SOX9 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Goat, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SOX9 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 56 kDa |
Target | SOX9 |
UniProt ID | P48436 |
Protein Sequence | Synthetic peptide located within the following region: PCPSGSGSDTENTRPQENTFPKGEPDLKKESEEDKFPVCIREAVSQVLKG |
NCBI | NP_000337 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CMD1, SRA1, CMPD1, SRXX2, SRXY10 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein is modified by phosphorylation, and a putative 49 kDa isoform also contains this immunizing peptide sequence.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein is modified by phosphorylation, and a putative 49 kDa isoform also contains this immunizing peptide sequence.
Host: Mouse, Target Name: SOX9, Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: SOX9, Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/ml.
WB Suggested Anti-SOX9 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate. SOX9 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
ICC, IF, IHC-P, WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating