SOX5 antibody

• Catalog Number: orb329718
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SOX5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SOX5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 84 kDa
• Target: SOX5
• UniProt ID: P35711
• Protein Sequence: Synthetic peptide located within the following region: PEPGMPVIQSTYGVKGEEPHIKEEIQAEDINGEIYDEYDEEEDDPDVDYG
• NCBI: NP_821078
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti L-SOX5 antibody, anti MGC35153 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human HepG2 tissue using SOX5 antibody

Western blot analysis of Hela cell lysate tissue using SOX5 antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The peptide is present in isoforms of 84, 83, 82, 71, and 42 kDa.

Host: Mouse, Target Name: SOX5, Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: SOX5, Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: SOX5, Sample Type: HepG2 cell lysates, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.0 ug/mL, Peptide Concentration: 0.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Host: Rabbit, Target: SOX5, Positive control (+): THP-1 (N30), Negative control (-): A549 (N03), Antibody concentration: 1 ug/mL.

WB Suggested Anti-SOX5 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Hela cell lysate.